English to Malay Meaning of activation


Activation :
pengaktifanpenyahaktifaninactivation
Facebook Twitter Linkedin Share More
Definitions of activation in English
Verb(1) put in motion or move to act(2) make active or more active(3) make more adsorptive(4) aerate (sewage(5) make (substances
Examples of activation in English
(1) You'll thereby complete three to six sets per workout, more than enough to activate muscle fibers.(2) fumes from cooking are enough to activate the alarm(3) If this is not enough to activate an alliance, what is?(4) Although we could use a lot more rain, most of our fields have had enough to activate the herbicides and early weed control generally has been good.(5) The energy that is required to activate molecules for a chemical reaction is the activation energy of the reaction.(6) But this offering is not enough to activate our intellect.(7) This results in a decrease in biological activity; but sulphonation is required to activate molecules as well.(8) It is almost impossible to deliver an inappropriate shock with an AED because the machine will allow the operator to activate the control only if an appropriate arrhythmia is detected.(9) My telescope gathers about 2,000 times as much light as the unaided eye, enough to activate the cone cells in the human retina, so some color appears.(10) Last week we had our first serious tornado watch with afternoon skies gone dark enough to activate the street lamps.(11) In Scotland, police were concerned enough to activate a nationwide intelligence centre to evaluate the terrorist threat north of the Border.(12) Repressors stifle gene expression by blocking the binding of activators , interfering with their recruiting efforts, or smothering the DNA in more protein.(13) One of the men had climbed through the parcel hatch and told her to keep away from the alarm button but she activated it as they left and saw they had a fourth man as a getaway driver outside.(14) Upon the application of Tc, the TetR repressor molecules are released from the tet operators and transcription is activated .(15) Those 21 strains that grew on AT in the presence of LexA were rejected because the suppression could have been due to mutations that potentiate weak activators .(16) This was the day the GSM operator activated its network and started selling prepaid cards to individual customers.
(1) activate ::
mengaktifkan
English to Malay Dictionary: activation

Meaning and definitions of activation, translation in Malay language for activation with similar and opposite words. Also find spoken pronunciation of activation in Malay and in English language.

Tags for the entry 'activation'

What activation means in Malay, activation meaning in Malay, activation definition, examples and pronunciation of activation in Malay language.

Learn Prepositions by Photos
Commonly confused words
form of verbs
Learn 300+ TOEFL words
Fill in the blanks
Topic Wise Words
Learn 3000+ common words
Words Everyday
Most Searched Words
GRE words
Android App
iPhone App
Chrome Extension

Blog List

Topic Wise Words

Learn 3000+ Common Words

Learn Common GRE Words

Learn Words Everyday

Your Favorite Words
Currently you do not have any favorite word. To make a word favorite you have to click on the heart button.
Your Search History